{"product_id":"proteintech-87438-1-rr","title":"Proteintech, 87438-1-RR, SRp20 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SRp20 (87438-1-RR) by Proteintech is a Recombinant antibody targeting SRp20 in WB, ELISA applications with reactivity to human, mouse, rat samples\n87438-1-RR targets SRp20 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  Jurkat cells,  K-562 cells,  RAW 264.7 cells,  NIH\/3T3 cells,  PC-12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSFRS3, also named as SRSF3 and SRP20, belongs to the splicing factor SR family. It may be involved in RNA processing in relation with cellular proliferation and\/or maturation. SFRS3 is one of the cognate factors. It is a proto-oncogene critical for cell proliferation and tumor induction and maintenance.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag1341 Product name: Recombinant human SRp20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-164 aa of BC000914 Sequence: MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRSFSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK Predict reactive species\nFull Name: splicing factor, arginine\/serine-rich 3\nCalculated Molecular Weight: 20 kDa\nObserved Molecular Weight: 20-24 kDa\nGenBank Accession Number: BC000914\nGene Symbol: SRSF3\nGene ID (NCBI): 6428\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P84103\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888826863785,"sku":"87438-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-87438-1-rr","provider":"Iright","version":"1.0","type":"link"}