{"product_id":"proteintech-87444-1-rr","title":"Proteintech, 87444-1-RR, ANKRD2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ANKRD2 (87444-1-RR) by Proteintech is a Recombinant antibody targeting ANKRD2 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples\n87444-1-RR targets ANKRD2 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue, human skeletal muscle tissue,  pig skeletal muscle tissue,  rat skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nANKRD2 belongs to the conserved muscle ankyrin repeat protein (MARP) family. Expression of MARPs is induced in response to physiologic stress, injury, and hypertrophy. Together with Ankrd1\/CARP and DARP, ANKRD2 are members of the MARP mechanosensing proteins that form a complex with titin (N2A)\/calpain 3 protease\/myopalladin. Ankrd2 is thought to have dual, structural and signaling roles, and could link the elastic I-band region as a stress sensor for transcriptional control in the nucleus.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2389 Product name: Recombinant human ANKRD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-303 aa of BC020817 Sequence: EAVMDGTMEDSEAVQRATALIEQRLAQEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAASHEPPPEPEEITGPVDEETFLKAAVEGKMKVIEKFLADGGSADTCDQFRRTALHRASLEGHMEILEKLLDNGATVDFQDRLDCTAMHWACRGGHLEVVKLLQSHGADTNVRDKEGDTALHDAVRLNRYKIIKLLLLHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSGRETPQPVPAQ Predict reactive species\nFull Name: ankyrin repeat domain 2 (stretch responsive muscle)\nCalculated Molecular Weight: 37 aa, 2 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC020817\nGene Symbol: ANKRD2\nGene ID (NCBI): 26287\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9GZV1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888693006505,"sku":"87444-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-87444-1-rr","provider":"Iright","version":"1.0","type":"link"}