{"product_id":"proteintech-87579-1-rr","title":"Proteintech, 87579-1-RR, EHHADH Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe EHHADH (87579-1-RR) by Proteintech is a Recombinant antibody targeting EHHADH in WB, ELISA applications with reactivity to human, mouse, rat samples\n87579-1-RR targets EHHADH in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, rat kidney tissue,  mouse liver tissue,  rat liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEHHADH, as the \"bifunctional catalytic center\" of peroxisome fatty acid β-oxidation, its expression and activity directly affect energy metabolism, inflammation level and cell fate. Gene defect causes serious neuro-renal tubular lesions, and abnormal expression is closely related to modern chronic diseases such as obesity, diabetes and tumor, which is one of the hot metabolic enzymes concerned by basic research and clinical transformation. It is mainly located in peroxisome, and some activity can be detected in mitochondrial inner membrane, and it is highly expressed in liver, kidney, heart and other organs.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag24237 Product name: Recombinant human EHHADH protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 108-284 aa of BC038948 Sequence: GCHYRIAHAEAQVGLPEVTLGLLPGARGTQLLPRLTGVPAALDLITSGRRILADEALKLGILDKVVNSDPVEEAIRFAQRVSDQPLESRRLCNKPIQSLPNMDSIFSEALLKMRRQHPGCLAQEACVRAVQAAVQYPYEVGIKKEEELFLYLLQSGQARALQYAFFAERKANKWSTP Predict reactive species\nFull Name: enoyl-Coenzyme A, hydratase\/3-hydroxyacyl Coenzyme A dehydrogenase\nCalculated Molecular Weight: 723 aa, 79 kDa\nObserved Molecular Weight: 69 kDa\nGenBank Accession Number: BC038948\nGene Symbol: EHHADH\nGene ID (NCBI): 1962\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q08426\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888739307689,"sku":"87579-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-87579-1-rr","provider":"Iright","version":"1.0","type":"link"}