{"product_id":"proteintech-87583-1-rr","title":"Proteintech, 87583-1-RR, ECEL1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ECEL1 (87583-1-RR) by Proteintech is a Recombinant antibody targeting ECEL1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n87583-1-RR targets ECEL1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spinal cord tissue, rat spinal cord tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe M13 family has seven members, including ECEL1 (endothelin-converting enzyme-like 1), one of the newest members. ECEL1 is expressed predominantly in the central nervous system. It has been proposed that the enzyme has a role in the nervous regulation of the respiratory system(PMID:14992683).It may contribute to the degradation of peptide hormones and be involved in the inactivation of neuronal peptides.It has 2 isoforms produced by alternative splicing and 3 glycosylation sites.It can be detected a band of 95kDa in CHO cells by western blot because of the heavily glycosylated(PMID:10961933).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag5460 Product name: Recombinant human ECEL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 425-775 aa of BC050453 Sequence: AQEMEGSDKPQELARVCLGQANRHFGMALGALFVHEHFSAASKAKVQQLVEDIKYILGQRLEELDWMDAETRAAARAKLQYMMVMVGYPDFLLKPDAVDKEYEFEVHEKTYFKNILNSIRFSIQLSVKKIRQEVDKSTWLLPPQALNAYYLPNKNQMVFPAGILQPTLYDPDFPQSLNYGGIGTIIGHELTHGYDDWGGQYDRSGNLLHWWTEASYSRFLRKAECIVRLYDNFTVYNQRVNGKHTLGENIADMGGLKLAYHAYQKWVREHGPEHPLPRLKYTHDQLFFIAFAQNWCIKRRSQSIYLQVLTDKHAPEHYRVLGSVSQFEEFGRAFHCPKDSPMNPAHKCSVW Predict reactive species\nFull Name: endothelin converting enzyme-like 1\nCalculated Molecular Weight: 88 kDa\nObserved Molecular Weight: 95 kDa\nGenBank Accession Number: BC050453\nGene Symbol: ECEL1\nGene ID (NCBI): 9427\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O95672\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888738816169,"sku":"87583-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-87583-1-rr","provider":"Iright","version":"1.0","type":"link"}