{"product_id":"proteintech-87624-2-rr","title":"Proteintech, 87624-2-RR, PELI1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PELI1 (87624-2-RR) by Proteintech is a Recombinant antibody targeting PELI1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n87624-2-RR targets PELI1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Ramos cells, PC-12 cells,  mouse brain tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPELI1 encodes pellino-1, an E3 ubiquitin-protein ligase pellino homolog. E3 ubiquitin ligase functions by catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Pellino-1 is involved in the TLR and IL-1 signaling pathways via interaction with the complex containing IRAK kinases and TRAF6. Pellino-1 can mediate 'Lys-63'-linked polyubiquitination of IRAK1 allowing subsequent NF-kappa-B activation thus playing a role in cellular inflammation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2683 Product name: Recombinant human PELI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 294-418 aa of BC011419 Sequence: MKRKDVVDEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD Predict reactive species\nFull Name: pellino homolog 1 (Drosophila)\nCalculated Molecular Weight: 418 aa, 46 kDa\nObserved Molecular Weight: 46-53 kDa\nGenBank Accession Number: BC011419\nGene Symbol: PELI1\nGene ID (NCBI): 57162\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q96FA3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888798159017,"sku":"87624-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-87624-2-rr","provider":"Iright","version":"1.0","type":"link"}