{"product_id":"proteintech-87669-1-rr","title":"Proteintech, 87669-1-RR, CXCL12\/SDF-1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CXCL12\/SDF-1 (87669-1-RR) by Proteintech is a Recombinant antibody targeting CXCL12\/SDF-1 in WB, ELISA applications with reactivity to mouse samples\n87669-1-RR targets CXCL12\/SDF-1 in WB, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Transfected with Mouse Cxcl12 HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIn adulthood, CXCL12 plays an important role in angiogenesis by recruiting endothelial progenitor cells (EPCs) from the bone marrow through a CXCR4 dependent mechanism (PMID: 17878755). It is this function of CXCL12 that makes it a very important factor in carcinogenesis and the neovascularisation linked to tumour progression (PMID: 16943240). CXCL12 also has a role in tumor metastasis where cancer cells that express the receptor CXCR4 are attracted to metastasis target tissues that release the ligand, CXCL12 (PMID: 11242036 ). In breast cancer, however, increased expression of CXCL12 determines a reduced risk of distant metastasis (PMID: 19646861; 17724466 ).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2402 Product name: recombinant mouse Cxcl12 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-89 aa of BC020297 Sequence: KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK Predict reactive species\nFull Name: chemokine (C-X-C motif) ligand 12\nCalculated Molecular Weight: 11 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC020297\nGene Symbol: Cxcl12\nGene ID (NCBI): 20315\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P40224\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888731115689,"sku":"87669-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-87669-1-rr","provider":"Iright","version":"1.0","type":"link"}