{"product_id":"proteintech-98036-1-rr","title":"Proteintech, 98036-1-RR, Anti-Mouse IL-15 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe IL-15 (98036-1-RR) by Proteintech is a Recombinant antibody targeting IL-15 in FC (Intra) applications with reactivity to mouse samples\n98036-1-RR targets IL-15 in FC (Intra) applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: Mouse PBMCs\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL-15 is a 4-α-helix bundle cytokine playing a pivotal role in stimulation of both innate and adaptive immune cells. It is produced primarily by keratinocytes, skeletal muscle cells, monocytes, and CD4+ T cells. It is a member of the common gamma chain family. The members of the common gamma chain family include the IL-2, IL-4, IL-7, IL-9, and IL-21 and require binding to the common gamma chain receptor for activation. It can be used in growth and maintenance of T and NK cells. It is also shown to be used in proliferation and functional effect of T cells for adoptive cell therapy. It is a glycosylated protein and HumanKine IL-15 appear as 12.5-25 kDa bands (PMID: 24587813, 26627006, 27849617, 31250350)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0359 Product name: recombinant mouse il15 protein Source: mammalian cells -derived, pHZ-KIsec-Cfc-2 Tag: C-FC Domain: 49-162 aa of NM_001254747 Sequence: NWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS Predict reactive species\nFull Name: interleukin 15\nCalculated Molecular Weight: 19 kDa\nGenBank Accession Number: NM_001254747\nGene Symbol: IL-15\nGene ID (NCBI): 16168\nRRID: AB_3672182\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P48346\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2-8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888571928745,"sku":"98036-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-98036-1-rr","provider":"Iright","version":"1.0","type":"link"}