{"product_id":"proteintech-98047-1-rr","title":"Proteintech, 98047-1-RR, Anti-Mouse CXCL1 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CXCL1 (98047-1-RR) by Proteintech is a Recombinant antibody targeting CXCL1 in FC (Intra) applications with reactivity to mouse samples\n98047-1-RR targets CXCL1 in FC (Intra) applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: LPS and Brefeldin A treated mouse splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.13 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCXCL1 a is a member of CXC family and also known as keratinocyte-derived chemokines (KC) or growth-related oncogene (GRO). CXCL1 is expressed by macrophages, neutrophils and epithelial cells. CXCL1 binding specifically to the CXC chemokine receptor CXCR2, is involved in fibrogenesis and angiogenesis. This protein also plays a role in inflammation and as a chemoattractant for neutrophils. CXCL1 is upregulated in some types of human cancer, including colorectal, bladder, breast, prostate and skin cancers.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0303 Product name: Recombinant mouse Cxcl1 protein (N-6*HIS) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-6*HIS Domain: 25-96 aa of NM_008176 Sequence: APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK Predict reactive species\nFull Name: chemokine (C-X-C motif) ligand 1\nCalculated Molecular Weight: 10kd\nGenBank Accession Number: NM_008176\nGene Symbol: Cxcl1\nGene ID (NCBI): 14825\nRRID: AB_3672194\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P12850-1\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2-8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888569438377,"sku":"98047-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-98047-1-rr","provider":"Iright","version":"1.0","type":"link"}