{"product_id":"proteintech-98080-1-rr","title":"Proteintech, 98080-1-RR, Anti-Mouse PD-1\/CD279 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe PD-1\/CD279 (98080-1-RR) by Proteintech is a Recombinant antibody targeting PD-1\/CD279 in FC, Blocking applications with reactivity to mouse samples\n98080-1-RR targets PD-1\/CD279 in FC, Blocking applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: anti-CD3\/CD28 treated mouse splenocytes\nPositive Blocking detected in: Recombinant protein\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\nBLOCKING: BLOCKING :\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProgrammed cell death 1 (PD-1, also known as CD279) is an immunoinhibitory receptor that belongs to the CD28\/CTLA-4 subfamily of the Ig superfamily. It is a 288 amino acid (aa) type I transmembrane protein composed of one Ig superfamily domain, a stalk, a transmembrane domain, and an intracellular domain containing an immunoreceptor tyrosine-based inhibitory motif (ITIM) as well as an immunoreceptor tyrosine-based switch motif (ITSM) (PMID: 18173375). PD-1 is expressed during thymic development and is induced in a variety of hematopoietic cells in the periphery by antigen receptor signaling and cytokines (PMID: 20636820). Engagement of PD-1 by its ligands PD-L1 or PD-L2 transduces a signal that inhibits T-cell proliferation, cytokine production, and cytolytic function (PMID: 19426218). It is critical for the regulation of T cell function during immunity and tolerance. Blockade of PD-1 can overcome immune resistance and also has been shown to have antitumor activity (PMID: 22658127; 23169436).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0918 Product name: Recombinant mouse PD-1 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 25-167 aa of NM_008798.2 Sequence: LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ Predict reactive species\nFull Name: programmed cell death 1\nCalculated Molecular Weight: 32 kDa\nGenBank Accession Number: NM_008798.2\nGene Symbol: PD-1\nGene ID (NCBI): 18566\nRRID: AB_3672227\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q02242\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888579137705,"sku":"98080-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-98080-1-rr","provider":"Iright","version":"1.0","type":"link"}