{"product_id":"proteintech-98095-1-rr","title":"Proteintech, 98095-1-RR, Anti-Human CD9 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CD9 (98095-1-RR) by Proteintech is a Recombinant antibody targeting CD9 in FC applications with reactivity to human samples\n98095-1-RR targets CD9 in FC applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: human PBMCs, human peripheral blood platelets\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe cell-surface molecule CD9, a member of the transmembrane-4 superfamily, interacts with the integrin family and other membrane proteins, and is postulated to participate in cell migration and adhesion. Expression of CD9 enhances membrane fusion between muscle cells and promotes viral infection in some cells (PMID:10459022). It is often used as a mesenchymal stem cell marker (PMID:18005405).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1037 Product name: recombinant human CD9 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 112-195 aa of NM_001769.4 Sequence: SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI Predict reactive species\nFull Name: CD9 molecule\nCalculated Molecular Weight: 25 kDa\nGenBank Accession Number: NM_001769.4\nGene Symbol: CD9\nGene ID (NCBI): 928\nRRID: AB_3672242\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P21926\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888547123369,"sku":"98095-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-98095-1-rr","provider":"Iright","version":"1.0","type":"link"}