{"product_id":"proteintech-98113-1-rr","title":"Proteintech, 98113-1-RR, Anti-Mouse CD30 Ligand\/TNFSF8 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CD30 Ligand\/TNFSF8 (98113-1-RR) by Proteintech is a Recombinant antibody targeting CD30 Ligand\/TNFSF8 in FC applications with reactivity to mouse samples\n98113-1-RR targets CD30 Ligand\/TNFSF8 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: Anti-CD3\/CD28 treated mouse splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD30 Ligand (CD30L), also named as TNFSF8 or CD153, is a type II transmembrane protein that belongs to the tumor necrosis factor (TNF) superfamily (PMID: 8391931). It is expressed on the surface of activated T cells, B cells, monocytes, macrophages, eosinophils, neutrophils, and mast cells (PMID: 26090498). CD30L interacts with its receptor, CD30, which is a cell surface protein expressed on a small subset of activated T and B lymphocytes, and a variety of lymphoid neoplasms, with the highest expression in classical Hodgkin lymphoma and anaplastic large cell lymphomas (PMID: 28885612). The CD30\/CD30L signaling is involved in pleiotropic downstream effects including differentiation, cell survival and death, NFkB activation, and production of cytokines (PMID: 38534788).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0667 Product name: Recombinant Mouse CD30 Ligand\/TNFSF8 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-6*His Domain: 68-239 aa of NM_009403.3 Sequence: QKKDSTPNTTEKAPLKGGNCSEDLFCTLKSTPSKKSWAYLQVSKHLNNTKLSWNEDGTIHGLIYQDGNLIVQFPGLYFIVCQLQFLVQCSNHSVDLTLQLLINSKIKKQTLVTVCESGVQSKNIYQNLSQFLLHYLQVNSTISVRVDNFQYVDTNTFPLDNVLSVFLYSSSD Predict reactive species\nFull Name: tumor necrosis factor (ligand) superfamily, member 8\nCalculated Molecular Weight: 27 kDa\nGenBank Accession Number: NM_009403.3\nGene Symbol: Tnfsf8\nGene ID (NCBI): 21949\nRRID: AB_3672260\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P32972\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888566259881,"sku":"98113-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-98113-1-rr","provider":"Iright","version":"1.0","type":"link"}