{"product_id":"proteintech-98162-1-rr","title":"Proteintech, 98162-1-RR, Anti-Rat CD90 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CD90 (98162-1-RR) by Proteintech is a Recombinant antibody targeting CD90 in FC applications with reactivity to rat samples\n98162-1-RR targets CD90 in FC applications and shows reactivity with rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: rat thymocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD90 (Thy-1) is a 25 kDa, GPI-linked membrane glycoprotein that belongs to immunoglobulin superfamily (PMID: 6177036; 6153212). Originally described as a brain thymus cross-reactive antigen, it is found in large quantities on mouse and rat thymocytes and central nervous system cells (PMID: 83175). CD90 has been postulated to be involved in cellular recognition, adherence, and T cell activation (PMID: 7683034).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: rat\nCited Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1463 Product name: Recombinant Rat CD90\/Thy1 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 20-130 aa of NM_012673.2 Sequence: QRVISLTACLVNQNLRLDCRHENNTNLPIQHEFSLTREKKKHVLSGTLGVPEHTYRSRVNLFSDRFIKVLTLANFTTKDEGDYMCELRVSGQNPTSSNKTINVIRDKLVKC Predict reactive species\nFull Name: Thy-1 cell surface antigen\nCalculated Molecular Weight: 18 kDa\nGenBank Accession Number: NM_012673.2\nGene Symbol: Thy1\nGene ID (NCBI): 24832\nRRID: AB_3672305\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P01830\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888532345001,"sku":"98162-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-98162-1-rr","provider":"Iright","version":"1.0","type":"link"}