{"product_id":"proteintech-98173-2-rr","title":"Proteintech, 98173-2-RR, Anti-Human CD69 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CD69 (98173-2-RR) by Proteintech is a Recombinant antibody targeting CD69 in FC applications with reactivity to human, monkey, non-human primates samples\n98173-2-RR targets CD69 in FC applications and shows reactivity with human, monkey, non-human primates samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: PHA treated human PBMCs, cynomolgus PBMCs\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD69, also known as AIM, EA-1, Leu-23, and MLR3, is a type II transmembrane glycoprotein that belongs to the C-type lectin superfamily (PMID: 8340758; 7804122). CD69 is constitutively expressed by mature thymocytes, platelets, several subsets of tissue resident immune cells (including resident memory T cells and gamma delta T cells), and is inducibly expressed by activated T cells, B cells, natural killer (NK) cells, monocytes, neutrophils (PMID: 8100776; 28475283). CD69 has been identified as an early activation marker of lymphocytes and is commonly used as a marker of activated lymphocytes and NK cells (PMID: 28475283; 25759842). It is involved in the regulation of immune responses (PMID: 15745855).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, monkey, non-human primates\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1791 Product name: Recombinant Human CD69 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 62-199 aa of NM_001781.2 Sequence: SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK Predict reactive species\nFull Name: CD69 molecule\nCalculated Molecular Weight: 23 kDa\nGenBank Accession Number: NM_001781.2\nGene Symbol: CD69\nGene ID (NCBI): 969\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q07108\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888696447145,"sku":"98173-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-98173-2-rr","provider":"Iright","version":"1.0","type":"link"}