{"product_id":"proteintech-98182-1-rr","title":"Proteintech, 98182-1-RR, Anti-Mouse TNFRSF9\/CD137 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe TNFRSF9\/CD137 (98182-1-RR) by Proteintech is a Recombinant antibody targeting TNFRSF9\/CD137 in FC applications with reactivity to mouse samples\n98182-1-RR targets TNFRSF9\/CD137 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: Con A treated mouse splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD137, also known as TNFRSF9 or 4-1BB, is an inducible T cell surface receptor that belongs to the tumor necrosis factor receptor superfamily. CD137 is a transmembrane protein expressed on the surface of activated T-cells. In addition, activation-dependent expression of CD137 has also been found in B lymphocytes, monocytes, and diverse nonlymphoid cell types. CD137 provides a co-stimulatory signal that enhances the survival, and differentiation of cells, and has a crucial role in the development of CD8 cytotoxic T cells and anti-tumor immunity. (PMID: 9826581; 23696891)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1627 Product name: Recombinant Mouse TNFRSF9\/CD137 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 24-187 aa of NM_001077509.1 Sequence: VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVL Predict reactive species\nFull Name: tumor necrosis factor receptor superfamily, member 9\nCalculated Molecular Weight: 28 kDa\nGenBank Accession Number: NM_001077509.1\nGene Symbol: Tnfrsf9\nGene ID (NCBI): 21942\nRRID: AB_3672323\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P20334\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888582250665,"sku":"98182-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-98182-1-rr","provider":"Iright","version":"1.0","type":"link"}