{"product_id":"proteintech-98193-1-rr","title":"Proteintech, 98193-1-RR, Anti-Mouse CD2 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CD2 (98193-1-RR) by Proteintech is a Recombinant antibody targeting CD2 in FC applications with reactivity to mouse samples\n98193-1-RR targets CD2 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: mouse splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.15 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD2 is a cell surface glycoprotein present on a majority of thymocytes, all mature T cells and subset of NK cells but not on B lymphocytes. It is a pan T-cell marker. CD2 interacts with lymphocyte function-associated antigen (LFA-3\/CD58) and CD48\/BCM1 to mediate adhesion between T-cells and other cell types. CD2 is implicated in the triggering of T-cells, the cytoplasmic domain is implicated in the signaling function.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1403 Product name: Recombinant Mouse CD2 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 23-203 aa of NM_013486.2 Sequence: RDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVRRGTLVAEFKRKKPPFLISETYEVLANGSLKIKKPMMRNDSGTYNVMVYGTNGMTRLEKDLDVRILERVSKPMIHWECPNTTLTCAVLQGTDFELKLYQGETLLNSLPQKNMSYQWTNLNAPFKCEAINPVSKESKMEVVNCPEKGLS Predict reactive species\nFull Name: CD2 antigen\nCalculated Molecular Weight: 38 kDa\nGenBank Accession Number: NM_013486.2\nGene Symbol: CD2\nGene ID (NCBI): 12481\nRRID: AB_3672330\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P08920\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888565702825,"sku":"98193-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-98193-1-rr","provider":"Iright","version":"1.0","type":"link"}