{"product_id":"proteintech-98207-1-rr","title":"Proteintech, 98207-1-RR, Anti-Mouse PDGFR beta\/CD140b Rabbit Recombinant Antibody","description":"Size: 100ug\nThe PDGFR beta\/CD140b (98207-1-RR) by Proteintech is a Recombinant antibody targeting PDGFR beta\/CD140b in FC applications with reactivity to mouse samples\n98207-1-RR targets PDGFR beta\/CD140b in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe Platelet-Derived Growth Factor Receptor Beta (PDGFR beta, also known as CD140b) is a receptor tyrosine kinase that plays a crucial role in various cellular processes, including cell proliferation, migration, and survival. In mice, PDGFR beta is particularly significant due to its expression in pericytes, which are cells that reside on the walls of capillaries and play a vital role in maintaining vascular stability and integrity (PMID: 20738866). In the central nervous system (CNS) of mice, PDGFR beta is predominantly expressed in pericytes and vascular smooth muscle cells. It is involved in the formation and maintenance of the blood-brain barrier, as well as in the regulation of angiogenesis and vascular stability. Research in mouse models has shown that PDGFR beta signaling is crucial for tissue repair and functional recovery after stroke. Mice with disrupted PDGFR beta signaling exhibit delayed recovery and increased infarction volume following cerebral ischemia (PMID: 21952111).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1533 Product name: Recombinant Mouse PDGFR beta protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 32-531 aa of NM_008809.2 Sequence: LVITPPGPEFVLNISSTFVLTCSGSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFTGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHGDEKAINISVIENGYVRLLETLGDVEIAELHRSRTLRVVFEAYPMPSVLWLKDNRTLGDSGAGELVLSTRNMSETRYVSELILVRVKVSEAGYYTMRAFHEDDEVQLSFKLQVNVPVRVLELSESHPANGEQTIRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGGDSQEVTVVPHSLPFKV Predict reactive species\nFull Name: platelet derived growth factor receptor, beta polypeptide\nCalculated Molecular Weight: 123kDa\nGenBank Accession Number: NM_008809.2\nGene Symbol: PDGFR beta\nGene ID (NCBI): 18596\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P05622-1\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888580317353,"sku":"98207-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-98207-1-rr","provider":"Iright","version":"1.0","type":"link"}