{"product_id":"proteintech-98226-1-rr","title":"Proteintech, 98226-1-RR, Anti-Human C5AR1\/CD88 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe C5AR1\/CD88 (98226-1-RR) by Proteintech is a Recombinant antibody targeting C5AR1\/CD88 in FC applications with reactivity to human samples\n98226-1-RR targets C5AR1\/CD88 in FC applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: human peripheral blood leukocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC5aR, also named CD88, is a G protein-coupled receptor for the anaphylatoxin C5a, a cleavage product of the complement cascade. The C5a ligand is a proinflammatory component of host defense. C5aR is activated upon binding of the C5a molecule. Receptor activation stimulates chemotaxis, granule enzyme release, intracellular calcium release, and superoxide anion production.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2185 Product name: Recombinant Human C5AR1\/CD88 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-37 aa of NM_001736.4 Sequence: MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPD Predict reactive species\nFull Name: complement component 5a receptor 1\nCalculated Molecular Weight: 39kDa\nGenBank Accession Number: NM_001736.4\nGene Symbol: C5aR\nGene ID (NCBI): 728\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P21730\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888538865833,"sku":"98226-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-98226-1-rr","provider":"Iright","version":"1.0","type":"link"}