{"product_id":"proteintech-98276-1-rr","title":"Proteintech, 98276-1-RR, Anti-Mouse IL-4RA\/CD124 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe IL-4RA\/CD124 (98276-1-RR) by Proteintech is a Recombinant antibody targeting IL-4RA\/CD124 in FC applications with reactivity to mouse samples\n98276-1-RR targets IL-4RA\/CD124 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: mouse splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL-4 receptor alpha chain (IL-4RA), also known as CD124, is a transmembrane glycoprotein expressed on a wide variety of hematopoietic and non-hematopoietic cells. It is a receptor for both IL-4 and IL-13. IL-4RA can complex with the common gamma chain (IL-2R gamma or CD132) and utilizes JAK1 and JAK2 for signal transduction, while complexes of IL-4RA with IL-13RA1 subunit mediate signals via JAK2 and Tyk2. The IL-4 response is involved in promoting Th2 differentiation. The IL-4\/IL-13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2176 Product name: Recombinant Mouse IL-4RA\/CD124 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 26-233 aa of NM_001008700.3 Sequence: IKVLGEPTCFSDYIRTSTCEWFLDSAVDCSSQLCLHYRLMFFEFSENLTCIPRNSASTVCVCHMEMNRPVQSDRYQMELWAEHRQLWQGSFSPSGNVKPLAPDNLTLHTNVSDEWLLTWNNLYPSNNLLYKDLISMVNISREDNPAEFIVYNVTYKEPRLSFPINILMSGVYYTARVRVRSQILTGTWSEWSPSITWYNHFQLPLIQR Predict reactive species\nFull Name: interleukin 4 receptor, alpha\nCalculated Molecular Weight: 88 kDa\nGenBank Accession Number: NM_001008700.3\nGene Symbol: Il4ra\nGene ID (NCBI): 16190\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P16382-1\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888577073321,"sku":"98276-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-98276-1-rr","provider":"Iright","version":"1.0","type":"link"}