{"product_id":"proteintech-98353-4-rr","title":"Proteintech, 98353-4-RR, Anti-Mouse CXCR2 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CXCR2 (98353-4-RR) by Proteintech is a Recombinant antibody targeting CXCR2 in FC applications with reactivity to mouse samples\n98353-4-RR targets CXCR2 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: mouse bone marrow cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCXCR2, also named as CD182, Cmkar2, Gpcr16, or Il8rb, belongs to the G-protein coupled receptor 1 family. CXCR2 is a receptor for interleukin-8, which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. CXCR2 binds to IL-8 with high affinity. CXCR2 also binds with high affinity to CXCL3, GRO\/MGSA and NAP-2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2228 Product name: Recombinant Mouse CXCR2 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 1-47 aa of NM_009909.3 Sequence: MGEFKVDKFNIEDFFSGDLDIFNYSSGMPSILPDAVPCHSENLEINS Predict reactive species\nFull Name: interleukin 8 receptor, beta\nCalculated Molecular Weight: 40 kDa\nGenBank Accession Number: NM_009909.3\nGene Symbol: Cxcr2\nGene ID (NCBI): 12765\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P35343\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888569929897,"sku":"98353-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-98353-4-rr","provider":"Iright","version":"1.0","type":"link"}