{"product_id":"proteintech-98360-2-rr","title":"Proteintech, 98360-2-RR, Anti-Mouse IL-4 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe IL-4 (98360-2-RR) by Proteintech is a Recombinant antibody targeting IL-4 in FC (Intra) applications with reactivity to mouse samples\n98360-2-RR targets IL-4 in FC (Intra) applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: PMA, Ionomycin and Brefeldin A treated C57BL\/6 Th2-polarized splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.13 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin-4 (IL-4), a member of the α-helical cytokine family, is produced by activated CD4+ T cells, basophils, and mast cells. It promotes the proliferation and differentiation of antigen-presenting cells. IL-4 also plays a pivotal role in antibody isotype switching and stimulates the production of IgE. This cytokine has been applied in the treatment of autoimmune disorders like multiple myeloma, cancer, psoriasis, and arthritis. IL-4 has also been extensively applied to inhibit detrimental effect of Th1. It may promote the growth of epithelial tumors by mediating increased proliferation and survival. (PMID: 24489573;3049907;21663408)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3750 Product name: Recombinant Mouse IL-4 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 21-140 aa of BC027514 Sequence: HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS Predict reactive species\nFull Name: interleukin 4\nGenBank Accession Number: BC027514\nGene Symbol: IL-4\nGene ID (NCBI): 16189\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P07750\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888575697065,"sku":"98360-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-98360-2-rr","provider":"Iright","version":"1.0","type":"link"}