{"product_id":"proteintech-98381-1-rr","title":"Proteintech, 98381-1-RR, Anti-Mouse OX40L\/TNFSF4 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe OX40L\/TNFSF4 (98381-1-RR) by Proteintech is a Recombinant antibody targeting OX40L\/TNFSF4 in FC applications with reactivity to mouse samples\n98381-1-RR targets OX40L\/TNFSF4 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: Anti-IgM and  CD40 treated BALB\/c  mouse splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe tumour necrosis factor ligand superfamily member 4 gene (TNFSF4, OX40L), which encodes for the T cell costimulatory molecule OX40 ligand, has been identified as a susceptibility gene for the development of systemic lupus erythematosus (SLE). OX40L\/TNFSF4\/CD252 is a co-stimulatory checkpoint protein expressed by several types of immune and non-immune cells (PMID: 15750594, 19778912). TNFSF4 mRNA is expressed in melanoma cell lines and melanoma samples, including those with low lymphocytic infiltrates, and is not associated with the ulceration status of the primary tumor (PMID: 31501955).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1573 Product name: Recombinant Mouse OX40L\/TNFSF4 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 51-198 aa of NM_009452.2 Sequence: SSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL Predict reactive species\nFull Name: tumor necrosis factor (ligand) superfamily, member 4\nCalculated Molecular Weight: 22kDa\nGenBank Accession Number: NM_009452.2\nGene Symbol: Tnfsf4\nGene ID (NCBI): 22164\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P43488\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888704377001,"sku":"98381-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-98381-1-rr","provider":"Iright","version":"1.0","type":"link"}