{"product_id":"proteintech-98403-3-rr","title":"Proteintech, 98403-3-RR, Anti-Human TNFSF18 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe TNFSF18 (98403-3-RR) by Proteintech is a Recombinant antibody targeting TNFSF18 in FC applications with reactivity to human samples\n98403-3-RR targets TNFSF18 in FC applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: HUVEC cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTNFSF18 (Tumor Necrosis Factor Superfamily Member 18), also known as GITRL (Glucocorticoid-Induced TNF Receptor Ligand) or AITRL (Activation-Induced T Cell Receptor Ligand), is a cytokine belonging to the tumor necrosis factor (TNF) ligand family. TNFSF18 is broadly expressed in various tissues, including the gallbladder, brain, and other tissues. TNFSF18 is expressed on the surface of antigen-presenting cells (APCs) such as dendritic cells, macrophages, and B cells. It is also found in endothelial cells, which play a role in the interaction between T lymphocytes and endothelial cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg32094 Product name: Recombinant Human TNFSF18 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: N-6*his Domain: 50-177 aa of BC069319 Sequence: QLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS Predict reactive species\nFull Name: tumor necrosis factor (ligand) superfamily, member 18\nCalculated Molecular Weight: 177 aa, 20 kDa\nGenBank Accession Number: BC069319\nGene Symbol: TNFSF18\nGene ID (NCBI): 8995\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UNG2\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888559607977,"sku":"98403-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-98403-3-rr","provider":"Iright","version":"1.0","type":"link"}