{"product_id":"proteintech-98436-3-rr","title":"Proteintech, 98436-3-RR, Anti-Mouse CD53 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CD53 (98436-3-RR) by Proteintech is a Recombinant antibody targeting CD53 in FC applications with reactivity to mouse samples\n98436-3-RR targets CD53 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: mouse splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.13 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD53 is also named as MOX44 and Tetraspanin-25 (Tspan-25). Tetraspanin CD53 is a member of the tetraspanin superfamily expressed exclusively within the immune compartment (PMID: 32440787). T cells depend on the phosphatase CD45 to initiate T cell receptor signaling. CD53 is shown to stabilize CD45 on the membrane and is required for optimal phosphatase activity and subsequent Lck activation. Together, CD53 as a regulator of CD45 activity required for T cell immunity (PMID: 35767951). CD53 is a marker for positively selected CD4+ CD8+ thymocytes (PMID: 11867561).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2684 Product name: Recombinant Mouse CD53 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 107-181 aa of NM_007651.3 Sequence: EQKLNTLVAEGLNDSIQHYHSDNSTMKAWDFIQTQLQCCGVNGSSDWTSGPPSSCPSGADVQGCYNKAKSWFHSN Predict reactive species\nFull Name: CD53 antigen\nCalculated Molecular Weight: 24 kDa\nGenBank Accession Number: NM_007651.3\nGene Symbol: Cd53\nGene ID (NCBI): 12508\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q61451\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888567341225,"sku":"98436-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-98436-3-rr","provider":"Iright","version":"1.0","type":"link"}