{"product_id":"proteintech-98481-2-rr","title":"Proteintech, 98481-2-RR, Anti-Mouse CD314\/NKG2D Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CD314\/NKG2D (98481-2-RR) by Proteintech is a Recombinant antibody targeting CD314\/NKG2D in FC applications with reactivity to mouse samples\n98481-2-RR targets CD314\/NKG2D in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: mouse splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD314, also known as NKG2D or Killer cell lectin-like receptor subfamily K member 1 (KLRK1), is a type II lectin-like transmembrane stimulatory receptor (PMID: 8436421). In mice, CD314 is expressed on NK cells, activated CD8(+) T cells and macrophages, and subsets of TCR gamma delta (+) and NK1.1 (+) T cells (PMID: 12150888). Various subfamilies of MHC class I-related glycoproteins have been identified as the ligands for mouse CD314, including RAET1A, RAET1B, RAET1C, RAET1D, RAET1E, H60 and MULT1 (PMID: 31720075).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3829 Product name: Recombinant Mouse CD314\/NKG2D protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 90-232 aa of NM_033078.4 Sequence: FKETFQPVLCNKEVPVSSREGYCGPCPNNWICHRNNCYQFFNEEKTWNQSQASCLSQNSSLLKIYSKEEQDFLKLVKSYHWMGLVQIPANGSWQWEDGSSLSYNQLTLVEIPKGSCAVYGSSFKAYTEDCANLNTYICMKRAV Predict reactive species\nFull Name: killer cell lectin-like receptor subfamily K, member 1\nCalculated Molecular Weight: 27 kDa\nGenBank Accession Number: NM_033078.4\nGene Symbol: CD314\nGene ID (NCBI): 27007\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O54709-1\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888566489257,"sku":"98481-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-98481-2-rr","provider":"Iright","version":"1.0","type":"link"}