{"product_id":"proteintech-98502-2-rr","title":"Proteintech, 98502-2-RR, Anti-Mouse CCL1 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CCL1 (98502-2-RR) by Proteintech is a Recombinant antibody targeting CCL1 in FC (Intra) applications with reactivity to mouse samples\n98502-2-RR targets CCL1 in FC (Intra) applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: Transfected HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCL1, also known as I-309 in human or TCA-3 in mice, is a small glycoprotein belonging to the CC chemokine family. It is predominantly expressed by activated T cells, monocytes, and endothelial cells, and primarily acts as a chemoattractant for monocytes and T cells. CCL1 binds to the receptor CCR8, which is expressed on monocytes, neutrophils, and T cells, including within the thymus. This chemokine may perform dual functions: as an inflammatory chemokine during leukocyte migration into inflammatory sites and as a constitutive chemokine during T cell selection in the thymus. Furthermore, CCL1 has been associated with allergic inflammation and the recruitment of Th2 cells, suggesting a role in allergic diseases such as asthma.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3293 Product name: Recombinant Mouse CCL1 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 24-92 aa of NM_011329.3 Sequence: KSMLTVSNSCCLNTLKKELPLKFIQCYRKMGSSCPDPPAVVFRLNKGRESCASTNKTWVQNHLKKVNPC Predict reactive species\nFull Name: chemokine (C-C motif) ligand 1\nCalculated Molecular Weight: 10KD\nGenBank Accession Number: NM_011329.3\nGene Symbol: Ccl1\nGene ID (NCBI): 20290\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P10146-1\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888560427177,"sku":"98502-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-98502-2-rr","provider":"Iright","version":"1.0","type":"link"}