{"product_id":"proteintech-98535-1-rr","title":"Proteintech, 98535-1-RR, Anti-Mouse IL-16 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe IL-16 (98535-1-RR) by Proteintech is a Recombinant antibody targeting IL-16 in FC (Intra) applications with reactivity to mouse samples\n98535-1-RR targets IL-16 in FC (Intra) applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: Transfected HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL-16 is a pleiotropic cytokine that functions as a chemoattractant, a modulator of T cell activation, and an inhibitor of HIV replication. It is mainly produced by T lymphocytes but also by other immune cells, neuronal cells, fibroblasts and epithelial cells. The signaling process of this cytokine is mediated by CD4. IL-16 induces chemotaxis of CD4+ cells such as lymphocytes, eosinophils, and dendritic cells by ligating CD4 directly at a site distinct from other ligands. Among its multiple functions, IL-16 is a T cell chemoattractant involved in T helper cell inflammatory responses and the regulation of both T cell growth, and responsiveness to regulatory cytokines. The cytokine function is exclusively attributed to the secreted C-terminal peptide, while the N-terminal product may play a role in cell cycle control.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3127 Product name: Recombinant Mouse IL-16 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 1205-1322 aa of NM_010551.3 Sequence: SAASASAASDISVESKEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTINRIFKGTEQGEMVQPGDEILQLAGTAVQGLTRFEAWNVIKALPDGPVTIVIRRTSLQCKQTTASADS Predict reactive species\nFull Name: interleukin 16\nCalculated Molecular Weight: 141 kDa\nGenBank Accession Number: NM_010551.3\nGene Symbol: Il16\nGene ID (NCBI): 16170\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O54824-1\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888572125353,"sku":"98535-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-98535-1-rr","provider":"Iright","version":"1.0","type":"link"}