{"product_id":"proteintech-98585-1-rr","title":"Proteintech, 98585-1-RR, Anti-Guinea Pig CD8b Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CD8b (98585-1-RR) by Proteintech is a Recombinant antibody targeting CD8b in FC applications with reactivity to guinea pig samples\n98585-1-RR targets CD8b in FC applications and shows reactivity with guinea pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: guinea pig splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD8b (T-cell surface glycoprotein CD8 beta chain) is an integral membrane glycoprotein that forms disulfide-linked heterodimers with CD8a (CD8 alpha chain). The CD8 alpha\/beta heterodimer is the predominant CD8 complex expressed on the cell surface (PMID: 1534146; 2111591). CD8 is a transmembrane glycoprotein predominantly expressed on the surface of cytotoxic T cells and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 serves as a co-receptor for the T cell receptor (TCR). Both CD8 and TCR recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. CD8 plays a role in T cell development and activation of mature T cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: guinea pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg7177 Product name: Recombinant guinea pig CD8B protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-168 aa of NM_001172877.1 Sequence: LQQSPHFLMLQTNQSATMTCESKTSSINGRLYWLRQRGAPSPDSHHEFLASGDFSNNIVYGRGMTSEMLTLSRLSTRFTLSLKHVKPEDSGVYFCMTIGHPELTFGMGTNLSVVDVLPTTAQPTTKTTPKKKKCQPPSPGPQKGLHC Predict reactive species\nFull Name: CD8 subunit beta\nCalculated Molecular Weight: 23 kDa\nGenBank Accession Number: NM_001172877.1\nGene Symbol: Cd8b\nGene ID (NCBI): 100379572\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q6W8W7\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888693924009,"sku":"98585-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-98585-1-rr","provider":"Iright","version":"1.0","type":"link"}