{"product_id":"proteintech-98658-2-rr","title":"Proteintech, 98658-2-RR, Anti-Mouse TNFSF15 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe TNFSF15 (98658-2-RR) by Proteintech is a Recombinant antibody targeting TNFSF15 in FC applications with reactivity to mouse samples\n98658-2-RR targets TNFSF15 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: Transfected HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTumor necrosis factor ligand superfamily member 15 (TNFSF15) is also named as TL1 and VEGI. And it belongs to the tumor necrosis factor family. It is a receptor for TNFRSF25 and TNFRSF6B. VEGI induced degradation of IκB alpha, and nuclear translocation of p65 subunit of NFκB by activating NFκB (PMID: 10597252). TL1A mediates activation and apoptosis of NFκB in DR3-expressing cell lines (PMID: 11911831). Overexpression by cancer cells of a secretable VEGI fusion protein resulted in abrogation of xenograft tumor progression.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg5273 Product name: Recombinant Mouse TNFSF15 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 61-252 aa of \/ Sequence: AGQLRVPGKDCMLRAITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL Predict reactive species\nFull Name: tumor necrosis factor (ligand) superfamily, member 15\nCalculated Molecular Weight: 28 kDa\nGenBank Accession Number: \/\nGene Symbol: Tnfsf15\nGene ID (NCBI): 326623\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q5UBV8\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888705097897,"sku":"98658-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-98658-2-rr","provider":"Iright","version":"1.0","type":"link"}