{"product_id":"proteintech-98679-1-rr","title":"Proteintech, 98679-1-RR, Anti-Mouse CD16\/CD32 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CD16\/CD32 (98679-1-RR) by Proteintech is a Recombinant antibody targeting CD16\/CD32 in FC applications with reactivity to mouse samples\n98679-1-RR targets CD16\/CD32 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: mouse splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD16 (FcγRIII) is a 50-70 kDa low affinity Fc receptor found on the surface of natural killer cells, neutrophil polymorphonuclear leukocytes, monocytes and macrophages. CD16 mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis. CD32 (FcγRII) is a 40 kD transmembrane glycoprotein that binds to the Fc region of IgG with low affinity. CD32 is present on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Rabbit anti mouse CD16\/32 antibody, clone 252820A1 is specific to the common epitope of CD16 and CD32. It can be used for blocking non-specific binding of immunoglobulins to the Fc receptors by preincubating the cells with the purified antibody at 1 ug per million cells in 100 uL volume for 5-10 minutes prior to immunostaining.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3474 Product name: Recombinant Mouse CD16 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 31-215 aa of NM_001356511 Sequence: ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT Predict reactive species\nFull Name: Fc receptor, IgG, low affinity III\nCalculated Molecular Weight: 30 kDa\nGenBank Accession Number: NM_001356511\nGene Symbol: Fcgr3\nGene ID (NCBI): 14131\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P08508\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888701984937,"sku":"98679-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-98679-1-rr","provider":"Iright","version":"1.0","type":"link"}