{"product_id":"proteintech-98684-1-rr","title":"Proteintech, 98684-1-RR, Anti-Human IL-22RA1 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe IL-22RA1 (98684-1-RR) by Proteintech is a Recombinant antibody targeting IL-22RA1 in FC applications with reactivity to human samples\n98684-1-RR targets IL-22RA1 in FC applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: COLO 205 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin-22 (IL-22), a member of the IL-10 family of cytokines, is important for the modulation of tissue responses during inflammation. IL-22 receptor is a heterodimer of the IL-10RB and IL-22RA1. IL-22RA1 belongs to the class II cytokine receptor family. It is expressed in a limited number of tissues including skin, colon, liver, lung, pancreas and kidney. The expression is lack in immune cells such as monocytes, T cells, and NK cells (PMID: 15308104). IL-22RA1 can also form a receptor for IL-20 and IL-24 with IL20RB (PMID: 23793061).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg5132 Product name: Recombinant human IL22RA1 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 16-228 aa of BC029273 Sequence: HAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWT Predict reactive species\nFull Name: interleukin 22 receptor, alpha 1\nCalculated Molecular Weight: 574 aa, 63 kDa\nGenBank Accession Number: BC029273\nGene Symbol: IL-22RA1\nGene ID (NCBI): 58985\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8N6P7\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888699035817,"sku":"98684-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-98684-1-rr","provider":"Iright","version":"1.0","type":"link"}