{"product_id":"proteintech-apc-fca98135","title":"Proteintech, APC-FcA98135, FcZero-rAb™ APC Anti-Mouse Fas\/CD95 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe Fas\/CD95 (APC-FcA98135) by Proteintech is a Recombinant antibody targeting Fas\/CD95 in FC applications with reactivity to mouse samples\nAPC-FcA98135 targets Fas\/CD95 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: mouse thymocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.1 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFas (CD95\/APO-1) is a transmembrane glycoprotein belonging to the tumor necrosis factor (TNF) receptor superfamily. It can mediate apoptosis by ligation with an agonistic anti-Fas antibody or Fas ligand. Stimulation of Fas results in the aggregation of its intracellular death domains, leading to the formation of the death-inducing signaling complex (DISC). FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The molecular mass of native Fas is 38 kDa, the high molecular weight form (40-55 kDa) of Fas is due to glycosylation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1376 Product name: Recombinant Mouse Fas\/CD95 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-169 aa of NM_007987.2 Sequence: QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNR Predict reactive species\nFull Name: Fas (TNF receptor superfamily member 6)\nCalculated Molecular Weight: 37kDa\nGenBank Accession Number: NM_007987.2\nGene Symbol: Fas\/CD95\nGene ID (NCBI): 14102\nConjugate: APC Fluorescent Dye\nExcitation\/Emission Maxima Wavelengths: 650 nm \/ 660 nm\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P25446\nStorage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888631206057,"sku":"APC-FcA98135","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-apc-fca98135","provider":"Iright","version":"1.0","type":"link"}