{"product_id":"proteintech-apc-fca98147","title":"Proteintech, APC-FcA98147, FcZero-rAb™ APC Anti-Mouse CTLA-4\/CD152 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CTLA-4\/CD152 (APC-FcA98147) by Proteintech is a Recombinant antibody targeting CTLA-4\/CD152 in FC applications with reactivity to mouse samples\nAPC-FcA98147 targets CTLA-4\/CD152 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: Con A treated mouse splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.1 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCTLA-4, also known as CD152, belonging to the immunoglobulin superfamily, is primarily found on activated T cells and regulatory T cells (Tregs). CTLA-4 is closely related to the T-cell costimulatory CD28, and both molecules bind to B7-1 and B7-2 on antigen-presenting cells. CTLA-4 acts as a negative regulatory molecule of T-cell responses. Besides the full-length transmembrane form, CTLA-4 also exists in a truncated soluble form (sCTLA-4).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0632 Product name: Recombinant Mouse CTLA-4 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 36-162 aa of NM_009843.4 Sequence: EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDF Predict reactive species\nFull Name: cytotoxic T-lymphocyte-associated protein 4\nCalculated Molecular Weight: 25 kDa\nGenBank Accession Number: NM_009843.4\nGene Symbol: CTLA-4\nGene ID (NCBI): 12477\nConjugate: APC Fluorescent Dye\nExcitation\/Emission Maxima Wavelengths: 650 nm \/ 660 nm\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P09793\nStorage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888630583465,"sku":"APC-FcA98147","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-apc-fca98147","provider":"Iright","version":"1.0","type":"link"}