{"product_id":"proteintech-apc-fca98212","title":"Proteintech, APC-FcA98212, FcZero-rAb™ APC Anti-Mouse CD70 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CD70 (APC-FcA98212) by Proteintech is a Recombinant antibody targeting CD70 in FC applications with reactivity to mouse samples\nAPC-FcA98212 targets CD70 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: LPS treated mouse splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.1 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD70, also known as tumor necrosis factor ligand superfamily member 7 (TNFSF7) or CD27 ligand (CD27L), is a transmembrane protein that plays a significant role in the immune system. It is the unique ligand for CD27, a member of the tumor necrosis factor receptor (TNFR) family, and is transiently upregulated upon stimulation of immune cells. CD70 is expressed on lymphocytes and dendritic cells, and its expression can be regulated by activation signals received via toll-like receptors (TLRs), CD40, and the antigen receptor MHC II. It provides complex and not completely understood signaling for B cell development. CD70 is also expressed on various solid tumors and hematolymphoid malignancies, where it may contribute to a poor prognosis. (PMID: 34991665; 26213107; 26098609)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1294 Product name: recombinant mouse CD70 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-6*His Domain: 45-195 aa of NM_011617.2 Sequence: SKQQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP Predict reactive species\nFull Name: CD70 antigen\nCalculated Molecular Weight: 22 kDa\nGenBank Accession Number: NM_011617.2\nGene Symbol: Cd70\nGene ID (NCBI): 21948\nConjugate: APC Fluorescent Dye\nExcitation\/Emission Maxima Wavelengths: 650 nm \/ 660 nm\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O55237\nStorage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888629797033,"sku":"APC-FcA98212","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-apc-fca98212","provider":"Iright","version":"1.0","type":"link"}