{"product_id":"proteintech-apc-fca98214","title":"Proteintech, APC-FcA98214, FcZero-rAb™ APC Anti-Human ICOS\/CD278 Rabbit Recombinant Antibody","description":"Size: 100tests\nThe ICOS\/CD278 (APC-FcA98214) by Proteintech is a Recombinant antibody targeting ICOS\/CD278 in FC applications with reactivity to human samples\nAPC-FcA98214 targets ICOS\/CD278 in FC applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: PHA treated human PBMCs\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 5 ul per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInducible T cell co-stimulator (ICOS) is related to the CD28 superfamily and is highly expressed on activated T cells as well as regulatory T cells and is crucial for the survival and function of T cells, Th2 cell differentiation, and lung inflammatory responses. Binding ICOS to ICOS-ligand (ICOS-L) activates a cascade of intracellular signaling molecules that prevent apoptosis and lead to the production of cytokines such as IL-4 and IL-13.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1642 Product name: recombinant human ICOS protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 21-140 aa of BC028210 Sequence: EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLK Predict reactive species\nFull Name: inducible T-cell co-stimulator\nCalculated Molecular Weight: 199 aa, 23 kDa\nGenBank Accession Number: BC028210\nGene Symbol: ICOS\nGene ID (NCBI): 29851\nConjugate: APC Fluorescent Dye\nExcitation\/Emission Maxima Wavelengths: 650 nm \/ 660 nm\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9Y6W8\nStorage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888624292009,"sku":"APC-FcA98214","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-apc-fca98214","provider":"Iright","version":"1.0","type":"link"}