{"product_id":"proteintech-apc-fca98215","title":"Proteintech, APC-FcA98215, FcZero-rAb™ APC Anti-Human BCMA\/TNFRSF17 Rabbit Recombinant Antibody","description":"Size: 100tests\nThe BCMA\/TNFRSF17 (APC-FcA98215) by Proteintech is a Recombinant antibody targeting BCMA\/TNFRSF17 in FC applications with reactivity to human samples\nAPC-FcA98215 targets BCMA\/TNFRSF17 in FC applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: U266 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBCMA (B cell maturation antigen), also known as TNFRSF17, is 20.2-kDa type III transmembrane glycoprotein and is a member of the TNF-receptor superfamily. This receptor is preferentially expressed in mature B lymphocytes and plasma cells, which may be important for B cell development and autoimmune response (PMID: 32943087; 9846698). BCMA has two agonist ligands: a proliferation-inducing ligand (APRIL) and BAFF. When BCMA binds to APRIL, it transmits signals of cell survival and proliferation (PMID: 27127303); when BCMA binds to BAFF, it mediates the activation of NF-kappaB and MAPK8\/JNK (PMID: 36140254). It has been found that the overexpression and activation of BCMA are associated with multiple myeloma (MM) in preclinical models and humans, supporting its potential utility as a therapeutic target for MM (PMID: 32055000; 32943087).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1812 Product name: Recombinant Human TNFRSF17 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-54 aa of BC058291 Sequence: MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA Predict reactive species\nFull Name: tumor necrosis factor receptor superfamily, member 17\nCalculated Molecular Weight: 184 aa, 20 kDa\nGenBank Accession Number: BC058291\nGene Symbol: TNFRSF17\nGene ID (NCBI): 608\nConjugate: APC Fluorescent Dye\nExcitation\/Emission Maxima Wavelengths: 650 nm \/ 660 nm\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q02223\nStorage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888614396073,"sku":"APC-FcA98215","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-apc-fca98215","provider":"Iright","version":"1.0","type":"link"}