{"product_id":"proteintech-ay7-fca98287","title":"Proteintech, AY7-FcA98287, FcZero-rAb™ APC-Cyanine7 Anti-Mouse CD19 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CD19 (AY7-FcA98287) by Proteintech is a Recombinant antibody targeting CD19 in FC applications with reactivity to mouse samples\nAY7-FcA98287 targets CD19 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: mouse splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD19 is a 95 kDa type I transmembrane glycoprotein belonging to the immunoglobulin superfamily (PMID: 2472450). It is expressed by B cells and follicular dendritic cells. CD19 is up-regulated at the step of B-lineage commitment during the differentiation of the hematopoietic stem cell, it remains on during subsequent stages of differentiation until finally down-regulated during terminal differentiation into plasma cells (PMID: 8528044). CD19 is involved in B cell development, activation and differentiation. It is the dominant component for the signaling complex on B cells that includes CD21 (CR2), CD81 (TAPA-1) and CD225 and acts as a critical co-receptor for BCR signal transduction (PMID: 23210908).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3194 Product name: Recombinant Mouse CD19 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 19-287 aa of NM_009844.2 Sequence: RPQKSLLVEVEEGGNVVLPCLPDSSPVSSEKLAWYRGNQSTPFLELSPGSPGLGLHVGSLGILLVIVNVSDHMGGFYLCQKRPPFKDIWQPAWTVNVEDSGEMFRWNASDVRDLDCDLRNRSSGSHRSTSGSQLYVWAKDHPKVWGTKPVCAPRGSSLNQSLINQDLTVAPGSTLWLSCGVPPVPVAKGSISWTHVHPRRPNVSLLSLSLGGEHPVREMWVWGSLLLLPQATALDEGTYYCLRGNLTIERHVKVIARSAVWLWLLRTGG Predict reactive species\nFull Name: CD19 antigen\nCalculated Molecular Weight: 60 kDa\nGenBank Accession Number: NM_009844.2\nGene Symbol: Cd19\nGene ID (NCBI): 12478\nConjugate: APC-Cyanine7 Fluorescent Dye\nExcitation\/Emission Maxima Wavelengths: 650 nm \/ 778 nm\nExcitation Laser: Red Laser (633 nm)\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P25918\nStorage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888750514345,"sku":"AY7-FcA98287","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-ay7-fca98287","provider":"Iright","version":"1.0","type":"link"}