{"product_id":"proteintech-biotin-fca98045","title":"Proteintech, Biotin-FcA98045, FcZero-rAb™ Biotin Anti-Mouse IFN-gamma Rabbit Recombinant Antibody","description":"Size: 100ug\nThe IFN-gamma (Biotin-FcA98045) by Proteintech is a Recombinant antibody targeting IFN-gamma in FC (Intra), ELISA applications with reactivity to mouse samples\nBiotin-FcA98045 targets IFN-gamma in FC (Intra), ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: PMA, Ionomycin and Brefeldin A treated C57BL\/6 Th1-polarized splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterferon gamma (IFN γ), is a type II interferon that provides immunity against bacterial, viral and protozoan infections. In its active form, IFN γ is a glycosylated, non-covalently linked homodimer of 29-32 kDa subunits. It is produced by a number of immune cell types including natural killer cells, natural killer T cells, and effector lymphocyte T cells following antigenic and inflammatory triggers. The IFN γ dimer binds to its cognate receptor which has two subunits: IFN-γR1 which is the ligand-binding chain (α chain) and IFN-γR2, the signal-transducing chain (β chain). Binding to the receptor activates the JAK\/STAT pathway which in turn activates IFN γ responsive genes. While IFN γ can inhibit viral replication, it also works as an immune-modulator and immune-stimulator by increasing surface expression of class I MHC proteins. (PMID: 19268625; 10688427)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0334 Product name: Recombinant Mouse IFN-gamma\/IFNG protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 23-155 aa of BC119063 Sequence: HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC Predict reactive species\nFull Name: interferon gamma\nCalculated Molecular Weight: 17 kDa\nGenBank Accession Number: BC119063\nGene Symbol: IFN gamma\nGene ID (NCBI): 15978\nConjugate: Biotin\nExcitation\/Emission Maxima Wavelengths: -\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P01580\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888631828649,"sku":"Biotin-FcA98045","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-biotin-fca98045","provider":"Iright","version":"1.0","type":"link"}