{"product_id":"proteintech-cl488-fca98187","title":"Proteintech, CL488-FcA98187, FcZero-rAb™ CoraLite® Plus 488 Anti-Human IFN-gamma Rabbit Recombinant Antibody","description":"Size: 100tests\nThe IFN-gamma (CL488-FcA98187) by Proteintech is a Recombinant antibody targeting IFN-gamma in FC (Intra) applications with reactivity to human samples\nCL488-FcA98187 targets IFN-gamma in FC (Intra) applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: PMA and ionomycin treated human PBMCs\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 5 ul per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterferon gamma (IFN γ), is a type II interferon that provides immunity against bacterial, viral and protozoan infections. In its active form, IFN γ is a glycosylated, non-covalently linked homodimer of 29-32 kDa subunits. It is produced by a number of immune cell types including natural killer cells, natural killer T cells, and effector lymphocyte T cells following antigenic and inflammatory triggers. The IFN γ dimer binds to its cognate receptor which has two subunits: IFN-γR1 which is the ligand-binding chain (α chain) and IFN-γR2, the signal-transducing chain (β chain). Binding to the receptor activates the JAK\/STAT pathway which in turn activates IFN γ responsive genes. While IFN γ can inhibit viral replication, it also works as an immune-modulator and immune-stimulator by increasing surface expression of class I MHC proteins. (PMID: 19268625; 10688427)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0004 Product name: Recombinant Human IFN-gamma protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc \u0026amp; 6*His Domain: 24-161 aa of BC070256 Sequence: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG Predict reactive species\nFull Name: IFN gamma\nCalculated Molecular Weight: 166 aa, 19 kDa\nGenBank Accession Number: BC070256\nGene Symbol: IFNG\nGene ID (NCBI): 3458\nENSEMBL Gene ID: ENSG00000111537\nConjugate: CoraLite® Plus 488 Fluorescent Dye\nExcitation\/Emission Maxima Wavelengths: 493 nm \/ 522 nm\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P01579\nStorage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888624357545,"sku":"CL488-FcA98187","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-cl488-fca98187","provider":"Iright","version":"1.0","type":"link"}