{"product_id":"proteintech-g10904-1-5c","title":"Proteintech, G10904-1-5C, MultiPro® 5CFLX Anti-Human IBA1 (Polyclonal)","description":"Size: 10ug\nThe IBA1 (G10904-1-5C) by Proteintech is a Polyclonal antibody targeting IBA1 in Single Cell (Intra) applications with reactivity to Human samples\nG10904-1-5C targets IBA1 in Single Cell (Intra) applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product.\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nSINGLE CELL (INTRA): \u0026lt;0.5ug\/test\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWhat is the molecular weight of IBA1?The molecular weight of IBA1 is 16.7 kD.What is IBA1?Ionized calcium-binding adaptor molecule 1 (IBA1), also known as Allograft inflammatory factor-1 (AIF-1), is an inflammation-responsive scaffold protein expressed and secreted from macrophages. Microglia response factor (MRF-1) and daintain are also similar, and likely identical, proteins (PMIDs: 29749461, 9630473, 23792284).What is the function of IBA1?IBA1 is necessary for macrophage survival, and it is also a key molecule in proinflammatory activity (PMID: 29749461).Where is IBA1 localized?IBA1 is a cytoplasmic protein, often expressed in immunocytes, macrophages, and microglia. It can be used as a marker for normal (not 'dark') microglia in brain tissue, as IBA1 is expressed by all microglial cell subpopulations (PMIDs: 29749461, 11943136, 26847266, 9630473).Is IBA1 upregulated in active immunophages?Yes; its expression is associated with inflammatory activity (PMID: 29749461).How do IBA1-positive microglia differ from microglia that express less or no IBA1?'Dark' microglia is a recently described phenotype associated with Alzheimer's disease pathology and chronic stress; these dark microglia express decreased IBA1 (often punctiform), and show distinct ultrastructural differences from 'normal' microglia as well as condensed and electron-dense cytoplasm and nucleoplasm. Normal microglia generally display strong, diffuse expression of IBA1. IBA1-positive microglial processes in normal conditions also have a strong tendency to exclusively contact synaptic elements, such as axon terminals, dendritic spines, and synaptic clefts (PMIDs: 29992181, 26847266).How is IBA1 related to Alzheimer's disease and pain?Exacerbated immunoactivity of IBA1, particularly in proximity to amyloid plaques, is prominently featured in AD pathology. IBA1, along with other microglial markers, are also associated with pain, and robust microglial reactions often follow spinal cord injury (PMIDs: 29992181, 23792284).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Oligo Conjugate\nType: Polyclonal\nImmunogen: CatNo: Ag1363 Product name: Recombinant human IBA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-147 aa of BC009474 Sequence: MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP Predict reactive species\nFull Name: MultiPro® 5CFLX Anti-Human IBA1 (Polyclonal)\nCalculated Molecular Weight: 17 kDa\nGenBank Accession Number: BC009474\nGene Symbol: IBA1\nGene ID (NCBI): 199\nENSEMBL Gene ID: ENSG00000204472\nRRID: AB_3673881\nConjugate: 5CFLX\nFull Oligo Sequence: CGGAGATGTGTATAAGAGACAGGGATAGGTGCCGACACCCATATAAGAAA\nBarcode Sequence: GGATAGGTGCCGACA\nForm: Liquid\nUNIPROT ID: P55008\nStorage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3.\nStorage Conditions: 2-8°C Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887729070249,"sku":"G10904-1-5C","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-g10904-1-5c","provider":"Iright","version":"1.0","type":"link"}