{"product_id":"proteintech-g16637-1-5c","title":"Proteintech, G16637-1-5C, MultiPro® 5CFLX Anti-Human AHNAK (Polyclonal)","description":"Size: 10ug\nThe AHNAK (G16637-1-5C) by Proteintech is a Polyclonal antibody targeting AHNAK in Single Cell (Intra) applications with reactivity to Human samples\nG16637-1-5C targets AHNAK in Single Cell (Intra) applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product.\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nSINGLE CELL (INTRA): \u0026lt;0.5ug\/test\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAHNAK, also known as desmoyokin, is described as a giant scaffold protein based on its large size (629 kDa) and ability to interact with different proteins to form multi-protein complexes. The bulk of the protein is assembled in 128-residue repetitive elements known as the central repeated\nunit (CRU). Its proposed functions are quite diverse, ranging from a role in the formation of the blood brain barrier, in cell architecture and migration, to the regulation of cardiac channels and muscle membrane repair. AHNAK is differentially expressed in some cancer cell lines. The expression of AHNAK is subsequently localized to the plasma membrane of keratinocytes in human epidermis. AHNAK has been reported in many intracellular locations including the nucleus, cytoplasm and plasma membrane.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Oligo Conjugate\nType: Polyclonal\nImmunogen: CatNo: Ag9986 Product name: Recombinant human AHNAK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-149 aa of BC000926 Sequence: MEKEEETTRELLLPNWQGSGSHGLTIAQRDDGVFVQEVTQNSPAARTGVVKEGDQIVGATIYFDNLQSGEVTQLLNTMGHHTVGLKLHRKGDRSPEPGQTWTREVFSSCSSEVVLNTPQPSALECKDQNKQKEASSQAGAVSVSTPNAG Predict reactive species\nFull Name: MultiPro® 5CFLX Anti-Human AHNAK (Polyclonal)\nCalculated Molecular Weight: 629 kDa\nGenBank Accession Number: BC000926\nGene Symbol: AHNAK\nGene ID (NCBI): 79026\nENSEMBL Gene ID: ENSG00000124942\nRRID: AB_3673890\nConjugate: 5CFLX\nFull Oligo Sequence: CGGAGATGTGTATAAGAGACAGCTGCGTACAGGTGGACCCATATAAGAAA\nBarcode Sequence: CTGCGTACAGGTGGA\nForm: Liquid\nUNIPROT ID: Q09666\nStorage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3.\nStorage Conditions: 2-8°C Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887727628457,"sku":"G16637-1-5C","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-g16637-1-5c","provider":"Iright","version":"1.0","type":"link"}