{"product_id":"proteintech-g60291-1-5c","title":"Proteintech, G60291-1-5C, MultiPro® 5CFLX Anti-Human TNF Alpha (7B8A11)","description":"Size: 10ug\nThe TNF Alpha (G60291-1-5C) by Proteintech is a Monoclonal antibody targeting TNF Alpha in Single Cell (Intra) applications with reactivity to Human samples\nG60291-1-5C targets TNF Alpha in Single Cell (Intra) applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product.\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nSINGLE CELL (INTRA): \u0026lt;0.5ug\/test\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTNF, as also known as TNF-alpha, or cachectin, is a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. It is expressed as a 26 kDa membrane bound protein and is then cleaved by TNF-alpha converting enzyme (TACE) to release the soluble 17 kDa monomer, which forms homotrimers in circulation. It is produced chiefly by activated macrophages, although it can be produced by many other cell types such as CD4+ lymphocytes, NK cells, neutrophils, mast cells, eosinophils, and neurons. It can bind to, and thus functions through its receptors TNFRSF1A\/TNFR1 and TNFRSF1B\/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, INS resistance, and cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Oligo Conjugate\nType: Monoclonal\nImmunogen: CatNo: Ag11413 Product name: Recombinant human TNF-a protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-233 aa of BC028148 Sequence: MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL Predict reactive species\nFull Name: MultiPro® 5CFLX Anti-Human TNF Alpha (7B8A11)\nCalculated Molecular Weight: 233 aa, 26 kDa\nGenBank Accession Number: BC028148\nGene Symbol: TNF-alpha\nGene ID (NCBI): 7124\nENSEMBL Gene ID: ENSG00000232810\nRRID: AB_3673901\nConjugate: 5CFLX\nFull Oligo Sequence: CGGAGATGTGTATAAGAGACAGACACCGTATGATAGGCCCATATAAGAAA\nBarcode Sequence: ACACCGTATGATAGG\nForm: Liquid\nUNIPROT ID: P01375\nStorage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3.\nStorage Conditions: 2-8°C Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888300118185,"sku":"G60291-1-5C","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-g60291-1-5c","provider":"Iright","version":"1.0","type":"link"}