{"product_id":"proteintech-g66489-1-5c","title":"Proteintech, G66489-1-5C, MultiPro® 5CFLX Anti-Human S100A4 (2G11B4)","description":"Size: 10ug\nThe S100A4 (G66489-1-5C) by Proteintech is a Monoclonal antibody targeting S100A4 in Single Cell (Intra) applications with reactivity to Human samples\nG66489-1-5C targets S100A4 in Single Cell (Intra) applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product.\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nSINGLE CELL (INTRA): \u0026lt;0.5ug\/test\n\u003cb\u003eBackground Information\u003c\/b\u003e\nS100A4 is a member of the S100 family of calcium-binding proteins. The S100 family members have been involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100A4 is known to localize to and function in the nucleus, cytoplasm of cells, and the extracellular space. S100A4 has also been shown to be associated with tumor growth, motility, invasion, metastasis, angiogenesis, apoptosis, and chemoresistance. It is  a fibroblast-specific protein associated with mesenchymal cell morphology and motility, is expressed during epithelial-mesenchymal transformations (EMT) in vivo (PMID: 9362334). It is a specific prognostic marker for renal survival in patients with IgAN (PMID: 16105038). It is also  an improved marker for lung fibroblasts that could be useful for investigating the pathogenesis of pulmonary fibrosis(PMID: 15618458). Overexpression of S100A4 is correlated with a worse prognosis inpatients with various types of cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Oligo Conjugate\nType: Monoclonal\nImmunogen: CatNo: Ag9019 Product name: Recombinant human S100A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC016300 Sequence: MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK Predict reactive species\nFull Name: MultiPro® 5CFLX Anti-Human S100A4 (2G11B4)\nCalculated Molecular Weight: 101 aa, 12 kDa\nGenBank Accession Number: BC016300\nGene Symbol: S100A4\nGene ID (NCBI): 6275\nENSEMBL Gene ID: ENSG00000196154\nRRID: AB_3673955\nConjugate: 5CFLX\nFull Oligo Sequence: CGGAGATGTGTATAAGAGACAGGTACCGCGCTCGAGACCCATATAAGAAA\nBarcode Sequence: GTACCGCGCTCGAGA\nForm: Liquid\nUNIPROT ID: P26447\nStorage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3.\nStorage Conditions: 2-8°C Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888299593897,"sku":"G66489-1-5C","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-g66489-1-5c","provider":"Iright","version":"1.0","type":"link"}