{"product_id":"proteintech-g66737-1-5c","title":"Proteintech, G66737-1-5C, MultiPro® 5CFLX Anti-Human IL-1 Beta (2A1B4)","description":"Size: 10ug\nThe IL-1 Beta (G66737-1-5C) by Proteintech is a Monoclonal antibody targeting IL-1 Beta in Single Cell (Intra) applications with reactivity to Human samples\nG66737-1-5C targets IL-1 Beta in Single Cell (Intra) applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product.\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nSINGLE CELL (INTRA): \u0026lt;0.5ug\/test\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin-1 is a pro-inflammatory cytokine with multiple biological effects. The IL-1 gene family encodes three proteins: IL-1α, IL-1β and their naturally occurring inhibitor Il-1RN. IL-1 Beta(IL-1β), mainly produced by blood monocytes and tissue macrophages, has been implicated in mediating both acute and chronic inflammation. IL-1β is known to be involved in a variety of cellular activities, including cell proliferation, differentiation and apoptosis. IL-1β is emerging as a key mediator of carcinogenesis that characterizes host-environment interactions. Human IL-1β is synthesized as a 31 kDa precursor. To gain activity, the precursor must be cleaved by caspase-1 between Asp116 and Ala117 to yield a 17 kDa mature form.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Oligo Conjugate\nType: Monoclonal\nImmunogen: CatNo: Ag26030 Product name: Recombinant human IL-1B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 117-269 aa of BC008678 Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS Predict reactive species\nFull Name: MultiPro® 5CFLX Anti-Human IL-1 Beta (2A1B4)\nCalculated Molecular Weight: 269 aa, 31 kDa\nGenBank Accession Number: BC008678\nGene Symbol: IL1B\nGene ID (NCBI): 3553\nENSEMBL Gene ID: ENSG00000125538\nRRID: AB_3673960\nConjugate: 5CFLX\nFull Oligo Sequence: CGGAGATGTGTATAAGAGACAGTGAGTGGATTGTTCTCCCATATAAGAAA\nBarcode Sequence: TGAGTGGATTGTTCT\nForm: Liquid\nUNIPROT ID: P01584\nStorage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3.\nStorage Conditions: 2-8°C Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888298905769,"sku":"G66737-1-5C","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-g66737-1-5c","provider":"Iright","version":"1.0","type":"link"}