{"product_id":"proteintech-g68080-1-5c","title":"Proteintech, G68080-1-5C, MultiPro® 5CFLX Anti-Human LASP1 (1G4B6)","description":"Size: 10ug\nThe LASP1 (G68080-1-5C) by Proteintech is a Monoclonal antibody targeting LASP1 in Single Cell (Intra) applications with reactivity to Human samples\nG68080-1-5C targets LASP1 in Single Cell (Intra) applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product.\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nSINGLE CELL (INTRA): \u0026lt;0.5ug\/test\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLASP1(LIM and SH3 protein 1), also known as MLN50, is a 261 amino acid protein that localizes to both the cytoplasm and the cytoskeleton(PMID: 7589475). LASP1 consists of an N-terminal LIM-domain with two zinc finger motifs, followed by two central actin-binding nebulin repeats, flanked by a linker region and a C-terminal SH3 domain (PMID: 17177073, 9848085). LASP-1 interacts with F-Actin and plays an important role in the regulation of Actin-associated cytoskeletal organization. Agonist-dependent changes in LASP1 phosphorylation may regulate Actin-related ion transport activities in epithelial cells (PMID: 15465019,12571245). Overexpression of LASP-1 is associated with breast cancer, and plays a role in tumor transformation and metastasis (PMID: 17956604).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Oligo Conjugate\nType: Monoclonal\nImmunogen: CatNo: Ag18101 Product name: Recombinant human LASP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 125-210 aa of BC012460 Sequence: EFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAA Predict reactive species\nFull Name: MultiPro® 5CFLX Anti-Human LASP1 (1G4B6)\nCalculated Molecular Weight: 30 kDa\nGenBank Accession Number: BC012460\nGene Symbol: LASP1\nGene ID (NCBI): 3927\nENSEMBL Gene ID: ENSG00000002834\nRRID: AB_3673971\nConjugate: 5CFLX\nFull Oligo Sequence: CGGAGATGTGTATAAGAGACAGACAATACACCAGCACCCCATATAAGAAA\nBarcode Sequence: ACAATACACCAGCAC\nForm: Liquid\nUNIPROT ID: Q14847\nStorage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3.\nStorage Conditions: 2-8°C Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888299233449,"sku":"G68080-1-5C","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-g68080-1-5c","provider":"Iright","version":"1.0","type":"link"}