{"product_id":"proteintech-pe-fca98387","title":"Proteintech, PE-FcA98387, FcZero-rAb™ PE Anti-Human CD16 Rabbit Recombinant Antibody","description":"Size: 100tests\nThe CD16 (PE-FcA98387) by Proteintech is a Recombinant antibody targeting CD16 in FC applications with reactivity to human samples\nPE-FcA98387 targets CD16 in FC applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: human peripheral blood leukocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD16 is a 50-70-kDa low affinity Fc receptor found on the surface of natural killer cells, neutrophil polymorphonuclear leukocytes, monocytes and macrophages. CD16 mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis. CD16 has been identified as Fc receptors FcγRIIIa (CD16a) and FcγRIIIb (CD16b), encoded by two nearly identical genes, FCGR3A and the FCGR3B.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg31662 Product name: Recombinant Human FCGR3A\/CD16a (F176V) protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc \u0026amp; 6*His Domain: 17-208 aa of BC017865 Sequence: GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQ Predict reactive species\nFull Name: Fc fragment of IgG, low affinity IIIa, receptor (CD16a)\nCalculated Molecular Weight: 254 aa, 29 kDa\nGenBank Accession Number: BC017865\nGene Symbol: CD16a\nGene ID (NCBI): 2214\nENSEMBL Gene ID: ENSG00000203747\nConjugate: PE Fluorescent Dye\nExcitation\/Emission Maxima Wavelengths: 496 nm, 565 nm \/ 578 nm\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P08637\nStorage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888615706793,"sku":"PE-FcA98387","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-pe-fca98387","provider":"Iright","version":"1.0","type":"link"}