{"product_id":"proteintech-pe-fca98407-3","title":"Proteintech, PE-FcA98407-3, FcZero-rAb™ PE Anti-Mouse IL-13RA2 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe IL-13RA2 (PE-FcA98407-3) by Proteintech is a Recombinant antibody targeting IL-13RA2 in FC applications with reactivity to mouse samples\nPE-FcA98407-3 targets IL-13RA2 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: Transfected HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.1 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL-13RA2, also named as IL-13R and CD213a2, belongs to the type I cytokine receptor family. It binds as a monomer with high affinity to interleukin-13 (IL13), but not to interleukin-4 (IL4). IL-13RA2 lacks the cytoplasmic domain for signaling, indicating that it acts as a decoy receptor. IL-13RA2 gene polymorphisms have been associated with systemic sclerosis (PMID: 16981293). Overexpression of IL-13RA2 gene has been reported in several types of cancer, including melanoma, lung cancer, and brain tumor, which makes it a potential immunotherapeutic target (PMID: 19895199; 24970476; 24021875).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3118 Product name: Recombinant Mouse IL-13RA2 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-334 aa of NM_008356.4 Sequence: LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK Predict reactive species\nFull Name: interleukin 13 receptor, alpha 2\nCalculated Molecular Weight: 44 kDa\nGenBank Accession Number: NM_008356.4\nGene Symbol: Il13ra2\nGene ID (NCBI): 16165\nConjugate: PE Fluorescent Dye\nExcitation\/Emission Maxima Wavelengths: 496 nm, 565 nm \/ 578 nm\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O88786-1\nStorage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888631894185,"sku":"PE-FcA98407-3","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-pe-fca98407-3","provider":"Iright","version":"1.0","type":"link"}