{"product_id":"proteintech-py5p5-fca98470","title":"Proteintech, PY5P5-FcA98470, FcZero-rAb™ PE-Cyanine5.5 Anti-Human CD8a Rabbit Recombinant Antibody","description":"Size: 100tests\nThe CD8a (PY5P5-FcA98470) by Proteintech is a Recombinant antibody targeting CD8a in FC applications with reactivity to human samples\nPY5P5-FcA98470 targets CD8a in FC applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: human PBMCs, Cynomolgus PBMCs\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD8 is a transmembrane glycoprotein composed of two disulfide-linked chains. It can be present as a homodimer of CD8α or as a heterodimer of CD8α and CD8β (PMID: 3264320; 8253791). CD8 is found on most thymocytes. The majority of class I-restricted T cells express mostly the CD8αβ heterodimer while CD8αα homodimers alone have been found on some gut intraepithelial T cells, on some T cell receptor (TCR) γδ T cells and on NK cells (PMID: 2111591; 1831127; 8420975). CD8 acts as a co-receptor that binds to MHC class-I and participates in cytotoxic T-cell activation (PMID: 8499079). During T cell development, CD8 is required for positive selection of CD4-\/CD8+ T cells (PMID: 1968084).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0819 Product name: Recombinant Human CD8a protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 22-182 aa of NM_001145873.1 Sequence: SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD Predict reactive species\nFull Name: CD8a molecule\nCalculated Molecular Weight: 26 kDa\nGenBank Accession Number: NM_001145873.1\nGene Symbol: CD8A\nGene ID (NCBI): 925\nENSEMBL Gene ID: ENSG00000153563\nConjugate: PE-Cyanine5.5 Fluorescent Dye\nExcitation\/Emission Maxima Wavelengths: 496 nm, 565 nm \/ 692 nm\nExcitation Laser: Blue Laser (488 nm)\/Green Laser (532 nm)\/Yellow-Green Laser (561 nm)\nForm: Liquid\nPurification Method: Protein A purification\nStorage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888623112361,"sku":"PY5P5-FcA98470","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-py5p5-fca98470","provider":"Iright","version":"1.0","type":"link"}