{"product_id":"abcam-ab268401","title":"Abcam, ab268401, Recombinant human Cdk9 + Cyclin K protein (Active)","description":"\u003cp\u003eSize: 5µg\u003cbr\u003e\nRecombinant human Cdk9 + Cyclin K protein (Active) is a Human Full Length protein, in the 1 to 372 aa range, expressed in Baculovirus infected Sf9 cells, with \u0026gt;85%, suitable for SDS-PAGE, FuncS.\u003cbr\u003e\nKey facts\u003cbr\u003e\nPurity:\u0026gt;85% SDS-PAGE,\u003cbr\u003e\nExpression system:Baculovirus infected Sf9 cells,\u003cbr\u003e\nTags:Tag free,\u003cbr\u003e\nApplications:FuncS, SDS-PAGESee reactivity dataSee the reactivity data table below for information on validated species and application combinations.,\u003cbr\u003e\nBiologically active:Yes,\u003cbr\u003e\nBiological activity:The specific activity of ab268401 was 3.1 nmol\/min\/min in a peptide kinase assay using PDKtide synthetic peptide substrate (KTFCGTPEYLAPEVRREP-RILSEEEQEMFRDFDYIADWC) as substrate.,\u003cbr\u003e\nAccession:P50750,\u003cbr\u003e\nAnimal free:No,\u003cbr\u003e\nCarrier free:No,\u003cbr\u003e\nSpecies:Human,\u003cbr\u003e\nStorage buffer:pH: 7.5Constituents: 25% Glycerol (glycerin, glycerine), 0.87% Sodium chloride, 0.79% Tris HCl, 0.31% Glutathione, 0.004% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.003% EDTA, 0.002% PMSF\u003c\/p\u003e\n\n\u003cp\u003eProperties and Storage Information:\u003cbr\u003e\nShipped at conditions-Dry Ice, Appropriate short-term storage conditions--80°C, Appropriate long-term storage conditions--80°C, Aliquoting information-Upon delivery aliquot, Storage information-Avoid freeze \/ thaw cycle\u003c\/p\u003e\n\n\u003cp\u003eSupplementary Information:\u003cbr\u003e\nThis supplementary information is collated from multiple sources and compiled automatically.\u003cbr\u003e\nCyclin-dependent kinase 9 (Cdk9) also known as PITALRE combines with Cyclin K to perform essential functions in cells. These proteins form a functional unit where Cdk9 with a molecular mass of approximately 42 kDa is a serine\/threonine protein kinase. Cyclin K helps regulate the activity of Cdk9 and has a molecular weight around 60 kDa. The expression of Cdk9 and Cyclin K occurs mainly in the nucleus of cells where they interact with other cellular components to regulate transcription and other cellular processes.\u003cbr\u003e\nBiological function summary\u003cbr\u003e\nCdk9 and Cyclin K belong to the positive transcription elongation factor b (P-TEFb) complex. This complex plays a significant role in controlling the elongation phase of transcription by RNA polymerase II. P-TEFb phosphorylates the carboxy-terminal domain (CTD) of RNA polymerase II which is necessary for efficient transcriptional elongation. Their activity is important for transcriptional regulation and hence for proper cell cycle progression and maintenance of gene expression profiles.\u003cbr\u003e\nPathways\u003cbr\u003e\nCdk9 and Cyclin K are integral to transcription-related pathways. They participate primarily in the regulation of gene expression by influencing the transcription of various genes necessary for cell growth and differentiation. The P-TEFb complex which includes other proteins such as Cyclin T is central in the transcriptional pathway through modulation of RNA polymerase II activity. This control impacts the overall pattern of protein expression in response to cellular signals.\u003cbr\u003e\nCdk9 and Cyclin K are implicated in certain cancers and cardiac hypertrophy. Dysregulation of Cdk9 has links to the development and progression of several cancers as its role in transcriptional regulation may lead to unchecked cell division and tumorigenesis. Also overexpression or hyperactivation of Cdk9 associates with aberrant cell growth in cancers. Furthermore abnormalities in Cdk9 activity and its interactions with Cyclin K have been observed in cardiac disease where disturbed transcriptional regulation can impact heart muscle function and structure.\u003c\/p\u003e","brand":"Abcam","offers":[{"title":"Default Title","offer_id":46843933982889,"sku":"ab268401","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/abcam-ab268401","provider":"Iright","version":"1.0","type":"link"}