{"product_id":"proteintech-10070-1-ap","title":"Proteintech, 10070-1-AP, UBC9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UBC9 (10070-1-AP) by Proteintech is a Polyclonal antibody targeting UBC9 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n10070-1-AP targets UBC9 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  mouse testis tissue,  rat testis tissue\nPositive IHC detected in: human lung cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUBC9 is also named as UBE2I, UBCE9 and belongs to the ubiquitin-conjugating enzyme family. It is a homologue of the E2 ubiquitin conjugating enzyme and participates in the covalent linking of SUMO-1 molecule to the target protein. This protein is present at a high level in spleen and lung. Moderate level of UBC9 is detected in kidney and liver. Low amount of UBC9 is observed in brain, whereas the 18 kDa band of UBC9 is barely visible or absent in heart and skeletal muscle. In heart and muscle extracts the UBC9 antibodies recognizes a 38 kDa protein band,but this band is not visible in extracts of other rat tissues(PMID:14739995).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0111 Product name: Recombinant human UBC9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-184 aa of BC004437 Sequence: VPGTLNMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYWLVAALAPLVAAPPRPSQGRLAGREWSTQAHPRDSQGPRLC Predict reactive species\nFull Name: ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast)\nCalculated Molecular Weight: 18 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC051289\nGene Symbol: UBC9\nGene ID (NCBI): 7329\nRRID: AB_513699\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P63279\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868931117225,"sku":"10070-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10070-1-ap","provider":"Iright","version":"1.0","type":"link"}