{"product_id":"proteintech-10093-2-ap","title":"Proteintech, 10093-2-AP, GTF2F1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GTF2F1 (10093-2-AP) by Proteintech is a Polyclonal antibody targeting GTF2F1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n10093-2-AP targets GTF2F1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells\nPositive IP detected in: K-562 cells\nPositive IHC detected in: mouse lung tissue, rat ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIn eukaryotic systems, the initiation of gene transcription involves the ordered assembly of a multiprotein complex on proximal promoter elements, consisting of RNA polymerase II and broad families of auxiliary transcription factors. Such factors can be divided into two major functional classes: the basal factors that are required for transcription of all Pol II genes, including TFIIA, B, D, E, F and H; and sequence specific factors that regulate gene expression. The basal transcription factors and Pol II form a specific multiprotein complex near the transcription start site by interacting with core promotor elements such as the TATA box generally located 25-30 base pairs upstream of the transcription start site. TFIIF, a heteromer composed of a small (RAP 30) and a large (RAP 74) subunit, acting at an intermediate stage in initiation complex formation, binds directly to RNA polymerase II in solution and decrease the affinity of RNA polymerase II for nonspecific DNA. In addition, TFIIF stimulates transcription elongation by RNA polymerase II.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0133 Product name: Recombinant human GTF2F1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 10-215 aa of BC000120 Sequence: NVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRGRRKASELRIHDLEDDLE Predict reactive species\nFull Name: general transcription factor IIF, polypeptide 1, 74kDa\nCalculated Molecular Weight: 58 kDa\nObserved Molecular Weight: 74 kDa\nGenBank Accession Number: BC000120\nGene Symbol: GTF2F1\nGene ID (NCBI): 2962\nRRID: AB_2114542\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P35269\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869547483305,"sku":"10093-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10093-2-ap","provider":"Iright","version":"1.0","type":"link"}